PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.004G322800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 404aa    MW: 42522.4 Da    PI: 6.6688
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.004G322800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.1e-161462148
                          TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                          +g+W++eEd +l+ +++++G+g +W + ++++g++R++k+c++rw++yl
  Sobic.004G322800.1.p 14 KGPWSPEEDAKLKAYIEEHGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                          79*********************************************97 PP

2Myb_DNA-binding38.72.3e-1269111246
                           SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           g +T+eE+ ++  +    G++ W+ Ia+ ++ gRt++++k++w++
  Sobic.004G322800.1.p  69 GDFTEEEEHIICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                           789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.714962IPR017930Myb domain
SuperFamilySSF466891.07E-2611109IPR009057Homeodomain-like
SMARTSM007173.1E-131364IPR001005SANT/Myb domain
PfamPF002491.1E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.4E-251569IPR009057Homeodomain-like
CDDcd001673.38E-101662No hitNo description
PROSITE profilePS5129421.92463117IPR017930Myb domain
SMARTSM007172.9E-1067115IPR001005SANT/Myb domain
PfamPF002495.1E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2270117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MGRAPCCDKA SVKKGPWSPE EDAKLKAYIE EHGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGD FTEEEEHIIC SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLLGK  120
RAPSRRARAN QDPYLAAGAG NMCSTSGGVN NNSAAAATST QALSASALER IQLHMRLQGI  180
YGAFGCSADA NDDSNAAAVA AAPQWPKLEA LLQANRLLPG SLPADAMATT VSVQQHHQHL  240
VDHQSLAAGA SDAAAVEGEQ QLSSAGGAAN YMAPGGFFER PKLGFYSPSA EAEAPAGGGV  300
EMNSGAPMVG GGYGGAGFGA HHQHDELYDF LYSKYGSVGE LAHDGHVPTL PELQCPDGAA  360
VVGADEKFSA WTASACDYGA AGGHQIQQGN SIMHDYVLGG YDQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008646370.10.0PREDICTED: uncharacterized protein LOC103627833
SwissprotQ9FKL24e-88MYB36_ARATH; Transcription factor MYB36
TrEMBLA0A109ND560.0A0A109ND56_SORBI; Uncharacterized protein (Fragment)
STRINGSb0826s002010.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Representative plantOGRP1206146
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.12e-80myb domain protein 36